PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G2651
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 371aa    MW: 40357.8 Da    PI: 6.1884
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G2651genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.49.5e-11170222557
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +    
  Gh_D05G2651 170 KRAKRIIANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTT 222
                  9****************************************999877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-17166230IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622168231IPR004827Basic-leucine zipper domain
PfamPF001702.8E-9170219IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11170221No hitNo description
Gene3DG3DSA:1.20.5.1701.6E-8170224No hitNo description
CDDcd147035.38E-24171220No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGTPKMQDPP SLDPNPDRPF PSNASSSTTQ TTPSFPNPTS FRGSYHRRAH SEVQFRIPDD  60
LDLVSDPFEG LGSEDDLFCT YVDIEKLGGS SKGSEDGGGA AGSSSGGSGR NPEGEEMSGV  120
SGKGEKNNGG GKGRHRYSNS IDGCSLMESI EAKKAMSPDK LAELWTIDPK RAKRIIANRQ  180
SAARSKERKA RYISELERKV QTLQTEATTL SAQLTLFQRD TTGLTTENTE LKLRLQAMEQ  240
QAQLRDALNE ALKKEVERLK IATGEITTST DTFNLGMHCM PYNQSSFFPP QPEHMQVGTQ  300
NIQMPPFHPL RSNMLTPNQS VVTSSNSQAF AGLMQQDPLG RLQGLDISSR SSHLVKSESP  360
SISADESSGT L
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.154420.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447231.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-105RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0D2SAA30.0A0A0D2SAA3_G
STRINGVIT_13s0067g02900.t011e-151(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-109bZIP family protein